Skip to main content

Table 3 Sequence variation in ‘H3.3’ and ‘H2A.X’ variants

From: A unified phylogeny-based nomenclature for histone variants

Kingdom Organism Histone Variant Residue
31 -
Residues
(85)86-89
Animals Homo H3.3 S A AIG
  Homo H3.2 A S AVM
Fungi Saccharomyces H3 S SAIG
Plants Arabidopsis H3.3 T H AVL
  Arabidopsis H3.1 A S AVA
Rhodophytes Porphyra H3.3? S- T AVL
  Porphyra H3.1? VG S AVL
Alveolates Tetrahymena H3.3 VS Q AI L
  Tetrahymena H3.1 AT S AV L
Heterokonts Thalassiosira H3.3? TA ST AVL
  Thalassiosira H3.1? AT GS AVL
Amoebozoa Dictyostelium H3.3? STQP AAIQ
  Dictyostelium H3.1? VNEV AAIE
Excavates Euglena H3 A NAIL
    Residues
109-
Animals Homo H2A.X PNIQAVLLPKKSATVGPKAPSGGKKATQASQEY
  Homo H2A.2.2 PNIQAVLLPKKTSHKPGKNK
Fungi Saccharomyces H2A.X PNIHQNLLPKKSAKATKASQEL
Plants Arabidopsis H2A.X.3 PNIHQTLLPSKVGKNKGDIGSASQEF
  Arabidopsis H2A.1 PNIHNLLLPKKAGASKPQED
Rhodophytes Griffithsia H2A.X PNIHQVLMPRKKTKGDASQEV
  Cyanidioschyzon H2A PNIHAVLLPKKKAKGE
Alveolates Tetrahymena H2A.X PNINPMLLPSKSKKTESRGGASQDL
  Tetrahymena H2A.1 PNINPMLLPSKTKKSTEPEH
Heterokonts Phaeodactylum H2A.X PNIHAILLPKKTIKTKGPSQDY
  Phaeodactylum H2A.3 PNIHAILLPKKSGPTK
Amoebozoa Dictyostelium H2A.X? PTPQQSTGEKKKKPSKKAAEGSSQIY
  Dictyostelium H2A PTPQSNTEGKKKKATSKKS
Excavates Giardia H2A.X RSAKEGREGKGSHRSQDL
  Trypanosoma H2A PSLNKALAKKQKSGKHAKATPSV
  1. RI ‘H3.3’ variants and ‘H2A.X’ variants are paraphyletic or polyphyletic, but have recognizable sequence features. Upper panel: Divergence between RI and RC H3 variants usually involves differences at residue 31 and residues 86 to 89. Lower panel: ‘H2A.X’ variants are distinguished from related H2A variants by bearing a consensus SQ(E/D)Φ phosphorylation motif at the C-terminus. Residue numbers refer to the human H3.3 and H2A.X protein sequences, and to orthologous positions in other variants.